- Recombinant Schizosaccharomyces pombe Uncharacterized protein new9 (new9)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1109950
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 6,799 Da
- E Coli or Yeast
- 20821
- Uncharacterized protein new9 (new9)
Sequence
MLRWSSTYTFGLLWLIIGSEAFHLNALKQDHLERMKQYDAKIRLAKHEFDDTSNETK